PAI1 (SERPINE1) mouse monoclonal antibody, clone 1D5, Purified
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PAI1 (SERPINE1) mouse monoclonal antibody, clone 1D5, Purified
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against SERPINE1
Applications | IHC, WB |
Reactivities | Human (Expected from sequence similarity: Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GFKIDDKGMAPALRH, from the internal region of the protein sequence according to NP_000593.1. |
Rabbit Polyclonal Serpin E1/PAI-1 Antibody
Applications | ELISA, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 300-400) [UniProt P05121] |
PAI1 (SERPINE1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal SERPINE1 Antibody (Center)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SERPINE1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-216 amino acids from the Central region of human SERPINE1. |
Rabbit Polyclonal Anti-SERPINE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the C terminal of human SERPINE1. Synthetic peptide located within the following region: VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM |
PAI1 (SERPINE1) mouse monoclonal antibody, clone MA-33H1F7, Liquid
Applications | ELISA, FN, IHC, WB |
Reactivities | Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SERPINE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the N terminal of human SERPINE1. Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ |
PAI1 (SERPINE1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant human PAI-1 |