Antibodies

View as table Download

PTGIS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PTGIS

Rabbit polyclonal anti-PTGIS antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PTGIS.

Rabbit Polyclonal Anti-PTGIS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGIS antibody: synthetic peptide directed towards the middle region of human PTGIS. Synthetic peptide located within the following region: EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS