Goat Polyclonal Antibody against KLK2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHQSLRPDEDSSHD, from the internal region of the protein sequence according to NP_005542.1; NP_001002231.1. |
Goat Polyclonal Antibody against KLK2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHQSLRPDEDSSHD, from the internal region of the protein sequence according to NP_005542.1; NP_001002231.1. |
Rabbit Polyclonal Anti-KLK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLK2 antibody: synthetic peptide directed towards the middle region of human KLK2. Synthetic peptide located within the following region: KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG |