Antibodies

Jump to Filters
View as table Download
DHTKD1 Rabbit Polyclonal Antibody
TA343242

USD 539.00

5 Days

Rabbit Polyclonal Anti-DHTKD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHTKD1 antibody is: synthetic peptide directed towards the N-terminal region of Human DHTKD1. Synthetic peptide located within the following region: YCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQE
DHTKD1 Rabbit Polyclonal Antibody
TA375458

USD 365.00

3 Weeks

DHTKD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human DHTKD1 (NP_061176.3).
Modifications Unmodified