Antibodies

View as table Download

Rabbit polyclonal anti-ARSA antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARSA.

Rabbit Polyclonal Anti-ARSA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARSA antibody: synthetic peptide directed towards the N terminal of human ARSA. Synthetic peptide located within the following region: DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR

Rabbit Polyclonal Anti-ARSA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARSA antibody: synthetic peptide directed towards the middle region of human ARSA. Synthetic peptide located within the following region: KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH

Goat Polyclonal Antibody against Arylsulfatase A

Applications WB
Reactivities Mouse (Expected from sequence similarity: Human, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-YDLSKDPGENYN, from the internal region of the protein sequence according to NP_000478.2.

ARSA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ARSA