Antibodies

View as table Download

Rabbit Polyclonal Anti-ARL6IP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARL6IP4 Antibody is: synthetic peptide directed towards the middle region of Human ARL6IP4. Synthetic peptide located within the following region: SSSSSSDGRKKRGKYKDKRRKKKKKRKKLKKKGKEKAEAQQVEALPGPSL

Rabbit Polyclonal Anti-ARL6IP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARL6IP4 Antibody is: synthetic peptide directed towards the middle region of Human ARL6IP4. Synthetic peptide located within the following region: SRSRGRGSEKRKKKSRKDTSRNCSASTSQERSKQKARRRTRSSSSSSSSS