Antibodies

View as table Download

CTNNA3 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human CTNNA3 (NP_001278062.1).
Modifications Unmodified

Rabbit Polyclonal Anti-CTNNA3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNA3 antibody is: synthetic peptide directed towards the N-terminal region of Human CTNNA3. Synthetic peptide located within the following region: PLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLLDKGEKIAQ