Antibodies

Jump to Filters
View as table Download
CSNK1G1 Rabbit Polyclonal Antibody
TA315512

USD 380.00

In Stock

Rabbit polyclonal anti-CKI-?1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CKI-?1.
Csnk1g1 Rabbit Polyclonal Antibody
TA329603

USD 539.00

5 Days

Rabbit polyclonal anti-Csnk1g1 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Csnk1g1 antibody: synthetic peptide directed towards the middle region of mouse Csnk1g1. Synthetic peptide located within the following region: FDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEV
Csnk1g1 Rabbit Polyclonal Antibody
TA329604

USD 485.00

5 Days

Rabbit polyclonal anti-CSNK1G1 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1G1 antibody: synthetic peptide directed towards the middle region of mouse CSNK1G1. Synthetic peptide located within the following region: CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW