Antibodies

View as table Download

Rabbit Polyclonal CACNB2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: DYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRT

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the C terminal of human CACNB2. Synthetic peptide located within the following region: TDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGLSRQE

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: ACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGS

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: AYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRTDRSA

Rabbit Polyclonal Anti-Cacnb2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cacnb2 antibody is: synthetic peptide directed towards the middle region of Rat Cacnb2. Synthetic peptide located within the following region: DFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQ

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: DACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQG

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: HLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGD

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the C terminal of human CACNB2. Synthetic peptide located within the following region: APHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASH

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: ADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVV

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: SRKSTPPSSGAKSADEQDQWKTAGLFWRFTTEHTPPYDVVPSMRPVVLVG

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the n terminal of human CACNB2. Synthetic peptide located within the following region: MNQGSGLDLLKISYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYT

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the C terminal of human CACNB2. Synthetic peptide located within the following region: RQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the n terminal of human CACNB2. Synthetic peptide located within the following region: IQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTSSDTTSNSFVR