Antibodies

View as table Download

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor

Goat Anti-F2R / PAR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRARRPESKATNAT, from the Internal region (near N-terminus) of the protein sequence according to NP_001983.2.

Rabbit polyclonal Thrombin Receptor antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor.

Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PAR1.

Rabbit Polyclonal Anti-F2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R.

Rabbit Polyclonal Anti-F2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA

Rabbit Polyclonal Anti-Thrombin Receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor