Rabbit Polyclonal Anti-ALAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP |
Rabbit Polyclonal Anti-ALAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT |
Rabbit Polyclonal Anti-ALAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALAD antibody: synthetic peptide directed towards the middle region of human ALAD. Synthetic peptide located within the following region: SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD |
Rabbit Polyclonal Anti-ALAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the C terminal of human ALAS2. Synthetic peptide located within the following region: PTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACN |
Rabbit Polyclonal Anti-ALAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: MPPTSSTPSLSRPGLGQAGKPDTGSHPPPTISTSIFLSCFPTIPLSRPRT |
Rabbit Polyclonal Anti-ALAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the C terminal of human ALAS2. Synthetic peptide located within the following region: VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA |
Rabbit Polyclonal Anti-UGT2B15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGT2B15 antibody: synthetic peptide directed towards the N terminal of human UGT2B15. Synthetic peptide located within the following region: IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY |
Rabbit Polyclonal Anti-HO 2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO 2 Antibody: A synthesized peptide derived from human HO 2 |
Heme Oxygenase 1 (HMOX1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to aa residues 12-25 + Cys-NH2 of the Human HO-1 protein |
Germany
Japan
United Kingdom
China