Antibodies

View as table Download

Rabbit Polyclonal anti-AGXT Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human AGXT

Rabbit Polyclonal antibody to ALAS-E (aminolevulinate, delta-, synthase 2)

Applications WB
Reactivities Human, Mouse (Predicted: Rat, Xenopus, Zebrafish, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 211 and 587 of ALAS-E (Uniprot ID#P22557)

Rabbit polyclonal antibody to PSPH (phosphoserine phosphatase)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 175 of PSPH (Uniprot ID#P78330)

Rabbit anti-DAO Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DAO

Rabbit Polyclonal Anti-CTH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

Rabbit Polyclonal Anti-PSAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSAT1 antibody: synthetic peptide directed towards the N terminal of human PSAT1. Synthetic peptide located within the following region: ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY

Goat Polyclonal Antibody against MAOB

Applications FC, IF, IHC, PEP-ELISA, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3.

Rabbit anti-CBS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CBS

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the N terminal of human ALAS2. Synthetic peptide located within the following region: VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ

Rabbit Polyclonal Anti-SARDH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SARDH antibody: synthetic peptide directed towards the middle region of human SARDH. Synthetic peptide located within the following region: DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ

Goat Polyclonal Antibody against BHMT

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQQLKELFEKQK, from the C Terminus of the protein sequence according to NP_001704.1.

Rabbit Polyclonal antibody to GLYCTK (glycerate kinase)

Applications WB
Reactivities Human, Mouse (Predicted: Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 144 and 523 of GLYCTK (Uniprot ID#Q8IVS8)