Rabbit Polyclonal Anti-PROC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PROC antibody: synthetic peptide directed towards the N terminal of human PROC. Synthetic peptide located within the following region: MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL |
Rabbit Polyclonal Anti-F10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F10 antibody: synthetic peptide directed towards the C terminal of human F10. Synthetic peptide located within the following region: STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ |
Rabbit Polyclonal Anti-F12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F12 antibody: synthetic peptide directed towards the N terminal of human F12. Synthetic peptide located within the following region: MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFP |
Rabbit Polyclonal Anti-FGA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGA antibody: synthetic peptide directed towards the middle region of human FGA. Synthetic peptide located within the following region: SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK |
Rabbit Polyclonal Anti-BDKRB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDKRB2 antibody: synthetic peptide directed towards the N terminal of human BDKRB2. Synthetic peptide located within the following region: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV |
Rabbit Polyclonal Anti-FGB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FGB antibody is: synthetic peptide directed towards the middle region of Human FGB. Synthetic peptide located within the following region: GNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNK |
Rabbit Polyclonal Anti-Thrombin Receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor |
Rabbit Polyclonal Anti-THRB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB |
Goat Polyclonal Anti-fibrinogen gamma chain Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-fibrinogen gamma chain Antibody: Peptide with sequence C-QDIANKGAKQS, from the internal region of the protein sequence according to NP_000500.2; NP_068656.2. |
Goat Polyclonal Anti-fibrinogen gamma chain (aa166-178) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-fibrinogen gamma chain (aa166-178) Antibody: Peptide with sequence C-KDTVQIHDITGKD, from the internal region of the protein sequence according to NP_000500.2; NP_068656.2. |
Goat Polyclonal Anti-fibrinogen alpha chain Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-fibrinogen alpha chain Antibody: Peptide with sequence C-STSYNRGDSTFES, from the internal region (near C terminus) of the protein sequence according to NP_000499.1; NP_068657.1. |
Rabbit anti SERPINC1/AT3(Antithrombin 3) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the intra domain 160-175aa of human AT3 protein. This sequence is identical to human, mouse, rat, dog, bovine and chicken. |
C1QA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human recombinant protein fragment of human C1QA ( NP_057075) produced in E.coli. |
Germany
Japan
United Kingdom
China