Antibodies

View as table Download

Rabbit Polyclonal Calnexin Antibody

Applications FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643]

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)

Rabbit Polyclonal ATG9A Antibody

Applications FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the C-terminus of human ATG9A (between residues 750-839). [Swiss-Prot# Q7Z3C6].

Rabbit polyclonal CNIH2 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Chicken)
Conjugation Unconjugated
Immunogen This CNIH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 31-59 amino acids from the N-terminal region of human CNIH2.

WNT3 (315-329) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human WNT3

Rabbit Polyclonal antibody to VAPA (VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Zebrafish, Chicken, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 29 and 122 of VAPA (Uniprot ID#Q9P0L0)

Rabbit Polyclonal GPR83 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 200-250 of human GPR83 was used as the immunogen for this antibody.

Rabbit Polyclonal antibody to MGAT3 (mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase)

Applications IF, IHC, WB
Reactivities Human (Predicted: Chicken)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 260 and 525 of MGAT3 (Uniprot ID#Q09327)

Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))

Applications IHC, WB
Reactivities Human (Predicted: Chicken, Chimpanzee)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726)

Rabbit Polyclonal antibody to RANKL (tumor necrosis factor (ligand) superfamily, member 11)

Applications IHC, WB
Reactivities Human (Predicted: Bovine, Chicken, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 253 and 317 of RANKL (Uniprot ID#O14788)

Rabbit polyclonal antibody to galanin receptor 2 (galanin receptor 2)

Applications IHC, WB
Reactivities Human (Predicted: Bovine, Chicken, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 243 and 336 of Galanin Receptor 2 (Uniprot ID#O43603)

Rabbit Polyclonal anti-CANX Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Dog, Porcine, Monkey, Rabbit, Sheep, Xenopus, Hamster, Guinea Pig
Conjugation Unconjugated
Immunogen A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH.

Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)

Applications IF, IHC, WB
Reactivities Human (Predicted: Chicken)
Conjugation Unconjugated
Immunogen This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6.

Rabbit Polyclonal Tmp21/p23 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Primate, Rabbit
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal sequence of the human TMP21 protein (within residues 100-200). [Swiss-Prot# P49755]

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT