Rabbit polyclonal Cyclin H (Ab-315) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D). |
Rabbit Polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 194 of CSA (Uniprot ID#Q13216) |
Rabbit polyclonal Phospho-CDK7(T170) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This CDK7 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T170 of human CDK7. |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 106 and 330 of CSA (Uniprot ID#Q13216) |
Rabbit Polyclonal Anti-GTF2H1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the N terminal of human GTF2H1. Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI |
Rabbit polyclonal Cyclin H (Thr315) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D) |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TF2H2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H2. |
Rabbit polyclonal anti-MAT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAT1. |
MNAT1 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MNAT1 |
ERCC3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ERCC3 |
Rabbit Polyclonal anti-CCNH antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the N terminal of human CCNH. Synthetic peptide located within the following region: PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY |
Rabbit Polyclonal Anti-GTF2H4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIA |
Germany
Japan
United Kingdom
China
