IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IGF1 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) IGF1 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IGF1 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
IGF1 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal anti-GNAS antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Carrier-free (BSA/glycerol-free) IGF1 mouse monoclonal antibody,clone OTI3A5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IGF1 mouse monoclonal antibody,clone OTI3A5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-CRH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRH |
IGF1 mouse monoclonal antibody,clone OTI3A5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
IGF1 mouse monoclonal antibody,clone OTI3A5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |