USD 509.00
2 Weeks
GNAS mouse monoclonal antibody,clone OTI12D9, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
GNAS mouse monoclonal antibody,clone OTI12D9, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
GNAS mouse monoclonal antibody,clone OTI12D9, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Dog, Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2) |
Anti-GNAS Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus |
GNAS mouse monoclonal antibody,clone OTI7H4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Dog, Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2) |
Anti-GNAS Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus |
GNAS mouse monoclonal antibody,clone OTI13G5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GNAS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
Rabbit anti-GNAS Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GNAS |
GNAS mouse monoclonal antibody,clone OTI7D7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-GNAS Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QAARSNSDGEKATK, from the internal region of the protein sequence according to NP_000507.1; NP_001070956.1; NP_001070957.1. |
G protein alpha S (GNAS) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human GNAS |
Rabbit Polyclonal Anti-GNAS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the C terminal of human GNAS. Synthetic peptide located within the following region: YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY |
GNAS mouse monoclonal antibody,clone OTI12D9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |