USD 509.00
2 Weeks
GNAS mouse monoclonal antibody,clone OTI7H4, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
GNAS mouse monoclonal antibody,clone OTI7H4, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
GNAS mouse monoclonal antibody,clone OTI7H4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI13G5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GNAS mouse monoclonal antibody,clone OTI13G5, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
GNAS mouse monoclonal antibody,clone OTI13G5, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal anti-GNAS antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
GNAS mouse monoclonal antibody,clone OTI12D9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GNAS mouse monoclonal antibody,clone OTI7D7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GNAS mouse monoclonal antibody,clone OTI13D7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI7D7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GNAS mouse monoclonal antibody,clone OTI7D7, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
GNAS mouse monoclonal antibody,clone OTI7D7, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI12D9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GNAS mouse monoclonal antibody,clone OTI7A6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GNAS mouse monoclonal antibody,clone OTI7A4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".