Antibodies

Jump to Filters
View as table Download
CD95 (FAS) Goat Polyclonal Antibody
TA305714

USD 520.00

5 Days

Goat Anti-FAS / CD95 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1.
CD95 (FAS) Rabbit Polyclonal Antibody
TA326787

USD 365.00

3 Weeks

FAS Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human FAS
CD95 (FAS) Rabbit Polyclonal Antibody
TA337864

USD 539.00

5 Days

Rabbit Polyclonal Anti-FAIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: 4C3-G7-B7-H5]
TA346945

USD 380.00

4 Weeks

Mouse Monoclonal FAS (C-terminus) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: OTI1F2]
TA506903S

USD 200.00

2 Days

FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human
Conjugation Unconjugated
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: OTI2C2]
TA506937S

USD 200.00

2 Days

FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications WB
Reactivities Human
Conjugation Unconjugated