Antibodies

Jump to Filters
View as table Download
Neurotrophin 4 (NTF4) Rabbit Polyclonal Antibody
TA322527

USD 380.00

In Stock

Anti-NTF4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 25-210 amino acids of human neurotrophin 4
NGF Rabbit Polyclonal Antibody
TA321493

USD 380.00

4 Weeks

Anti-NGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 80-94 amino acids of human nerve growth factor (beta polypeptide)
BDNF Rabbit Polyclonal Antibody
TA323908

USD 380.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor
BDNF Rabbit Polyclonal Antibody
TA327032

USD 365.00

3 Weeks

Rabbit anti-BDNF Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BDNF
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
AP23334PU-N

USD 560.00

2 Weeks

Neurotrophin 3 (NTF3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide mapping at the middle region of Human Neurotrophin-3
NGF Rabbit Polyclonal Antibody
TA347902

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-NGF beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NGF beta Antibody: A synthesized peptide derived from human NGF beta
BDNF Rabbit Polyclonal Antibody
AP23288PU-N

USD 560.00

2 Weeks

BDNF rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide mapping at the middle region of human BDNF
Fas Ligand (FASLG) (C-term) Rabbit Polyclonal Antibody
AP23382PU-N

USD 560.00

2 Weeks

Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
TA342144

USD 539.00

5 Days

Rabbit polyclonal Anti-Ntf3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ntf3 antibody is: synthetic peptide directed towards the N-terminal region of Ntf3. Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY