Rabbit polyclonal Anti-Sema3f Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH |
Rabbit polyclonal anti-Neuropilin-1 antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 816 of mouse Neuropilin 1 |
Rabbit anti-NRP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NRP1 |
Rabbit Polyclonal Anti-SDF 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
Rabbit Polyclonal anti-EPHA3 Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPHA3 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-EPHA3 antibody
| Applications | WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHA3. |
Rabbit polyclonal EPHA3 (Ab-602) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EPHA3. |
Rabbit polyclonal anti-Ephrin-A4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Ephrin-A4 |
Rabbit polyclonal NTN1 Antibody (C-term)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This NTN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 568-596 amino acids from the C-terminal region of human NTN1. |
Rabbit Polyclonal Anti-EPHA3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA3 Antibody: A synthesized peptide derived from human EPHA3 |
Goat Anti-Netrin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KFQQREKKGKCKKA, from the C Terminus of the protein sequence according to NP_004813.2. |
Rabbit Polyclonal Anti-CXCL12 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL12 antibody: synthetic peptide directed towards the middle region of human CXCL12. Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
Rabbit Polyclonal Anti-SLIT3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLIT3 antibody: synthetic peptide directed towards the N terminal of human SLIT3. Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV |
Germany
Japan
United Kingdom
China
