Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Anti-STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog, Mouse, Rat |
Conjugation | Biotin |
Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog, Mouse, Rat |
Conjugation | HRP |
Anti-STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Anti-STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-STK3/STK4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human STK3/STK4 |
Rabbit Polyclonal Anti-STK3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
Rabbit Polyclonal Anti-STK3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the N terminal of human STK3. Synthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG |
STK3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human STK3 |