Antibodies

View as table Download

Rabbit Polyclonal Anti-EYA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EYA3 antibody: synthetic peptide directed towards the middle region of human EYA3. Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA

Rabbit Polyclonal Anti-EYA3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EYA3 antibody is: synthetic peptide directed towards the middle region of Human EYA3. Synthetic peptide located within the following region: YQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKN