Antibodies

View as table Download

USD 190.00

USD 380.00

In Stock

Rabbit polyclonal anti-GPR103 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR103.

Rabbit polyclonal anti-GPR103 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GPR103.

Rabbit Polyclonal Anti-QRFPR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-QRFPR antibody: synthetic peptide directed towards the C terminal of human QRFPR. Synthetic peptide located within the following region: FSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENS

Rabbit Polyclonal Anti-GPR103 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR103 Antibody: A synthesized peptide derived from human GPR103