Antibodies

View as table Download

Rabbit polyclonal antibody to KHS (mitogen-activated protein kinase kinase kinase kinase 5)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 417 and 482 of KHS

Rabbit Polyclonal Anti-MAP4K5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAP4K5 Antibody is: synthetic peptide directed towards the C-terminal region of Human MAP4K5. Synthetic peptide located within the following region: KSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILAGHENS

Rabbit Polyclonal Anti-MAP4K5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAP4K5 Antibody: synthetic peptide directed towards the middle region of human MAP4K5. Synthetic peptide located within the following region: QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA