Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) MUT mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Anti-Mut Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mut antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mut. Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP

MUT Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MUT