Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
USD 509.00
2 Weeks
USD 509.00
5 Days
SNAI1 mouse monoclonal antibody,clone 1H7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
5 Days
SNAI1 mouse monoclonal antibody,clone 1H7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit Polyclonal Antibody against SNAI1 (N-term R8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SNAI1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human SNAI1. |
Rabbit polyclonal SNAI1 (Ser246) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SNAI1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SNAI1 Antibody: synthetic peptide directed towards the N terminal of human SNAI1. Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL |
Active filters
Target Symbol
- SNAIL
Applications
- WB
Families
- Druggable Genome
Pathways
- Adherens junction