Antibodies

View as table Download

Rabbit polyclonal BMI1 Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This BMI1 antibody is generated from rabbits immunized with BMI1 recombinant protein.

Rabbit Polyclonal Antibody against Bmi1

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region (within residues 1-100) of the human Bmi1 protein. [Swiss-Prot# P35226]

Rabbit anti-BMI1 Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMI1

Rabbit Polyclonal Anti-BMI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCGF4 Antibody: synthetic peptide directed towards the C terminal of human PCGF4. Synthetic peptide located within the following region: TPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG