Antibodies

Jump to Filters
View as table Download
VSIG1 (C-term) Rabbit Polyclonal Antibody
AP54520PU-N

USD 580.00

2 Weeks

VSIG1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 300-330 amino acids from the C-terminal region of human VSIG1
VSIG1 Rabbit Polyclonal Antibody
TA333389

USD 539.00

5 Days

Rabbit Polyclonal Anti-VSIG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-VSIG1 Antibody: synthetic peptide directed towards the N terminal of human VSIG1. Synthetic peptide located within the following region: SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN