Rabbit Polyclonal OCIAD1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | OCIAD1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human OCIAD1. |
Rabbit Polyclonal OCIAD1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | OCIAD1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human OCIAD1. |
OCIAD1 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human OCIAD1 (NP_060300.1). |
Modifications | Unmodified |
Rabbit Polyclonal Anti-OCIAD1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OCIAD1 |
Rabbit Polyclonal Anti-OCIAD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OCIAD1 antibody: synthetic peptide directed towards the C terminal of human OCIAD1. Synthetic peptide located within the following region: QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK |
OCIAD1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OCIAD1 |