Rabbit Polyclonal Anti-Foxd2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Foxd2 antibody: synthetic peptide directed towards the c terminal of mouse Foxd2. Synthetic peptide located within the following region: GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC |
Rabbit Polyclonal anti-FOXD2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXD2 antibody: synthetic peptide directed towards the N terminal of human FOXD2. Synthetic peptide located within the following region: LPARSGPRAPRDVLPHGHEPPAEEAEADLAEDEEESGGCSDGEPRALASR |
Germany
Japan
United Kingdom
China