Rabbit Polyclonal antibody to CAPZB (capping protein (actin filament) muscle Z-line, beta)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Pig, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 256 of CAPZB |
CAPZB (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CAPZB |
CAPZB (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human CAPZB |
Goat Polyclonal Antibody against CAPZB
| Applications | WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NDLVEALKRKQQC, from the C Terminus of the protein sequence according to NP_004921. |
Rabbit Polyclonal Anti-CAPZB Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Capzb antibody is: synthetic peptide directed towards the C-terminal region of Rat Capzb. Synthetic peptide located within the following region: VEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEAL |
CAPZB Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CAPZB |
CAPZB (N-term) guinea pig polyclonal antibody, Serum
| Applications | WB |
| Reactivities | Bovine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic N-terminal domain (aa 19-33:VGTADYGGASDQSDQ-C) of bovine F-actin β3 subunit capping protein, coupled to KLH. |
Germany
Japan
United Kingdom
China
