Rabbit Polyclonal antibody to C9orf78 (chromosome 9 open reading frame 78)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 239 of C9orf78 (Uniprot ID#Q9NZ63) |
Rabbit Polyclonal Anti-C9orf78 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C9orf78 Antibody is: synthetic peptide directed towards the middle region of Human C9orf78. Synthetic peptide located within the following region: NRRDEDADMMKYIETELKKRKGIVEHEEQKVKPKNAEDCLYELPENIRVS |
Germany
Japan
United Kingdom
China
