Antibodies

Jump to Filters
View as table Download
MSH2 Rabbit Polyclonal Antibody
TA368134

USD 380.00

4 Weeks

MSH2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MSH2
MSH2 Mouse Monoclonal Antibody [Clone ID: 1B3=3A2B8C]
AM06094SU-N

USD 465.00

2 Weeks

MSH2 mouse monoclonal antibody, clone 1B3=3A2B8C, Ascites

Applications ELISA, IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
MSH2 Rabbit Polyclonal Antibody
TA324411

USD 580.00

5 Days

Rabbit polyclonal MSH2 Antibody (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MSH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 637-665 amino acids from the Central region of human MSH2.
MSH2 Rabbit Polyclonal Antibody
TA372365

USD 380.00

4 Weeks

MSH2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MSH2
MSH2 Rabbit Polyclonal Antibody
TA346018

USD 539.00

5 Days

Rabbit Polyclonal Anti-MSH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG
MSH2 Rabbit Monoclonal Antibody [Clone ID: R03-1F3]
TA384803

USD 380.00

4 Weeks

MSH2 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
MSH2 Mouse Monoclonal Antibody [Clone ID: 1184CT1.3.2]
TA328162

USD 580.00

5 Days

Mouse monoclonal anti-MSH2 antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
MSH2 Rabbit Polyclonal Antibody
TA346017

USD 485.00

5 Days

Rabbit Polyclonal Anti-MSH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV
MSH2 Rabbit Monoclonal Antibody [Clone ID: 1B11-14-16]
TA399825

USD 630.00

2 Weeks

Anti-MSH2 [1B11-14-16], Rabbit IgG, kappa

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format for improved compatibility with existing reagents assays and techniques.
MSH2 Mouse Monoclonal Antibody [Clone ID: 1B11-14-16]
TA399826

USD 630.00

2 Weeks

Anti-MSH2 [1B11-14-16], Mouse IgG2b, kappa

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
MSH2 Rabbit Monoclonal Antibody [Clone ID: RM375]
TA398554

USD 545.00

5 Days

Rabbit monoclonal to MSH2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
MSH2 Rabbit Monoclonal Antibody [Clone ID: RM478]
TA398621

USD 545.00

5 Days

Rabbit monoclonal antibody to MSH2(DNA mismatch repair protein MSH2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated