Antibodies

View as table Download

RUNX1T1 (ETO) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RUNX1T1 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RUNX1T1 (ETO) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RUNX1T1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RUNX1T1 antibody: synthetic peptide directed towards the middle region of human RUNX1T1. Synthetic peptide located within the following region: LHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAI

Rabbit Polyclonal AML-ETO Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AML-ETO antibody: the AML-ETO (RUNX1) fusion protein, using 3 different KLH-conjugated synthetic peptides. The antibody recognizes the ETO (RUNX1T1) part of the fusion protein.

Rabbit Polyclonal Anti-RUNX1T1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RUNX1T1 antibody: synthetic peptide directed towards the middle region of human RUNX1T1. Synthetic peptide located within the following region: RQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHA