RUNX1T1 (ETO) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RUNX1T1 (ETO) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RUNX1T1 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RUNX1T1 (ETO) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RUNX1T1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RUNX1T1 antibody: synthetic peptide directed towards the middle region of human RUNX1T1. Synthetic peptide located within the following region: LHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAI |
Rabbit Polyclonal AML-ETO Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AML-ETO antibody: the AML-ETO (RUNX1) fusion protein, using 3 different KLH-conjugated synthetic peptides. The antibody recognizes the ETO (RUNX1T1) part of the fusion protein. |
Rabbit Polyclonal Anti-RUNX1T1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RUNX1T1 antibody: synthetic peptide directed towards the middle region of human RUNX1T1. Synthetic peptide located within the following region: RQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHA |