Antibodies

View as table Download

aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) aFGF mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-Fgf1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Fgf1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR

aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FGF1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human FGF1