Antibodies

Jump to Filters
View as table Download
FBP2 Mouse Monoclonal Antibody [Clone ID: AT1E11]
AM50022PU-N

USD 430.00

3 Weeks

FBP2 mouse monoclonal antibody, clone AT1E11, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
FBP2 Mouse Monoclonal Antibody [Clone ID: AT1E11]
AM50022PU-S

USD 315.00

3 Weeks

FBP2 mouse monoclonal antibody, clone AT1E11, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
FBP2 (C-term) Rabbit Polyclonal Antibody
AP17363PU-N

USD 580.00

2 Weeks

FBP2 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human FBP2
FBP2 Rabbit Polyclonal Antibody
TA342529

USD 539.00

5 Days

Rabbit Polyclonal Anti-FBP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBP2 antibody: synthetic peptide directed towards the middle region of human FBP2. Synthetic peptide located within the following region: YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY
FBP2 Rabbit Polyclonal Antibody
TA346521

USD 539.00

5 Days

Rabbit Polyclonal Anti-FBP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBP2 antibody: synthetic peptide directed towards the middle region of human FBP2. Synthetic peptide located within the following region: YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ