Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-PRKAA2 (AMPK1/AMPK2, Phospho-Ser485/Ser491) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanAMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G- SP-V-S). |
| Modifications | Phospho-specific |
Goat Anti-PRKAA2 Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CPLDALNTTKP, from the internal region of the protein sequence according to NP_006243.2. |
Anti-PRKAA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to N terminal 14 amino acids of human protein kinase, AMP-activated, alpha 1 catalytic subunit |
Rabbit Polyclonal Anti-GABARAP
| Applications | WB |
| Reactivities | Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
Goat Polyclonal Anti-INS Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human Insulin produced in E. coli as a fusion protein. |
Rabbit Polyclonal AMPK1 (Ser485) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK1 around the phosphorylation site of Serine 485 |
| Modifications | Phospho-specific |
Rabbit Polyclonal AMPK alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK alpha |
Insulin (INS) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Applications
- WB
Conjugates
- Unconjugated
Pathways
- Regulation of autophagy