Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI13B9

Applications WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody,clone OTI3B11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MCEE (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 135-164 amino acids from the C-terminal region of Human MCEE

Rabbit Polyclonal Anti-MCEE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCEE antibody: synthetic peptide directed towards the C terminal of human MCEE. Synthetic peptide located within the following region: DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH

MCEE mouse monoclonal antibody, clone OTI9E12 (formerly 9E12)

Applications WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody,clone OTI13B9

Applications WB
Reactivities Human
Conjugation Unconjugated