Rabbit Polyclonal Anti-ODF2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ODF2 |
Rabbit Polyclonal Anti-ODF2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ODF2 |
ODF2 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 630-829 of human ODF2 (NP_702911.1). |
Rabbit Polyclonal Anti-ODF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ODF2 Antibody: synthetic peptide directed towards the N terminal of human ODF2. Synthetic peptide located within the following region: MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG |
Rabbit polyclonal Cenexin-1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This protein-A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a truncated recombinant protein hCenexin1. |
Rabbit Polyclonal Anti-ODF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ODF2 Antibody: synthetic peptide directed towards the N terminal of human ODF2. Synthetic peptide located within the following region: TCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDSERLMEQQG |
ODF2 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Chimpanzee, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues near the carboxy terminus |
ODF2 pSer796 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Chimpanzee, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues near S796 of human cenexin-1 |