Antibodies

View as table Download

Rabbit Polyclonal Anti-ODF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ODF2

ODF2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 630-829 of human ODF2 (NP_702911.1).

Rabbit Polyclonal Anti-ODF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ODF2 Antibody: synthetic peptide directed towards the N terminal of human ODF2. Synthetic peptide located within the following region: MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG

Rabbit polyclonal Cenexin-1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This protein-A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a truncated recombinant protein hCenexin1.

Rabbit Polyclonal Anti-ODF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ODF2 Antibody: synthetic peptide directed towards the N terminal of human ODF2. Synthetic peptide located within the following region: TCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDSERLMEQQG

ODF2 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Chimpanzee, Human, Monkey
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues near the carboxy terminus

ODF2 pSer796 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Chimpanzee, Human, Monkey
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues near S796 of human cenexin-1