MDH1 sheep polyclonal antibody, Ig Fraction
Applications | ELISA, IHC, IP, WB |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |
Immunogen | Purified Malate Dehydrogenase from pig heart |
MDH1 sheep polyclonal antibody, Ig Fraction
Applications | ELISA, IHC, IP, WB |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |
Immunogen | Purified Malate Dehydrogenase from pig heart |
Goat Polyclonal Anti-MDH1 / MOR2 (aa211-223) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MDH1 / MOR2 (aa211-223) Antibody: Peptide with sequence C-PDVNHAKVKLQGK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1. |
Goat Polyclonal Anti-MDH1 / MOR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MDH1 / MOR2 Antibody: Peptide with sequence TNCLTASKSAPSIPK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1. |
MDH1 rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Malic dehydrogenase is isolated and purified from Human erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Malic dehydrogenase is isolated and purified from Human erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Malic dehydrogenase is isolated and purified from Human placenta. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Malic dehydrogenase is isolated and purified from Human placenta. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-MDH1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MDH1 |
Rabbit Polyclonal Anti-MDH1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MDH1 antibody: synthetic peptide directed towards the middle region of human MDH1. Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV |
MDH1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MDH1 |
MDH1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human MDH1 (NP_005908.1). |
Modifications | Unmodified |