Rabbit Polyclonal Anti-POMT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human POMT1 |
Rabbit Polyclonal Anti-POMT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human POMT1 |
Rabbit Polyclonal Anti-POMT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-POMT1 Antibody: synthetic peptide directed towards the middle region of human POMT1. Synthetic peptide located within the following region: LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL |
Rabbit Polyclonal Anti-POMT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POMT2 antibody: synthetic peptide directed towards the middle region of human POMT2. Synthetic peptide located within the following region: RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC |
Rabbit Polyclonal Anti-POMT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POMT2 antibody: synthetic peptide directed towards the middle region of human POMT2. Synthetic peptide located within the following region: AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS |