SRPRB mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
SRPRB mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SRPRB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-SRPRB Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the middle region of human SRPRB. Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE |