Antibodies

View as table Download

HAND1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HAND1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HAND1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-HAND1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAND1 antibody: synthetic peptide directed towards the N terminal of human HAND1. Synthetic peptide located within the following region: CHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGR