Rabbit Polyclonal Anti-MAP4K2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAP4K2 |
Rabbit Polyclonal Anti-MAP4K2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAP4K2 |
Rabbit Polyclonal Anti-MAP4K2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2. Synthetic peptide located within the following region: TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR |
Rabbit Polyclonal Anti-MAP4K2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2. Synthetic peptide located within the following region: HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAE |