BMP6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6. |
BMP6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6. |
BMP6 mouse monoclonal antibody,clone OTI1B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI4A3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI6G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI8B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI1B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI4A3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI8B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI6G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BMP6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BMP6 |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
BMP6 mouse monoclonal antibody,clone OTI1B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI4A3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI8B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI6G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |