Rabbit anti-TGM3 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TGM3 |
Rabbit anti-TGM3 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TGM3 |
Rabbit Polyclonal Anti-TGM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGM3 antibody: synthetic peptide directed towards the N terminal of human TGM3. Synthetic peptide located within the following region: MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS |
Goat Polyclonal Antibody against Transglutaminase 3 (aa598-610)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TLEVLNEARVRKP, from the internal region of the protein sequence according to NP_003236.3. |
TGM3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TGM3 |