Rabbit Anti-synaptophysin 2 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Rabbit Anti-synaptophysin 2 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Rabbit Polyclonal Anti-SYNPR Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Synpr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV |