Antibodies

View as table Download

ITGA8 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1032-1061 amino acids from the C-terminal region of human ITGA8

Rabbit Polyclonal Anti-ITGA8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA8 antibody: synthetic peptide directed towards the N terminal of human ITGA8. Synthetic peptide located within the following region: GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI

ITGA8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 907-1000 of human ITGA8 (NP_003629.2).
Modifications Unmodified