Rabbit Polyclonal Anti-RAN Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-RAN Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-RAN Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 200-216 amino acids of Human Ras-related nuclear protein |
Anti-RAN Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 200-216 amino acids of Human Ras-related nuclear protein |
RAN Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RAN |
RAN rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 170-200 of Human RAN. |
Goat Polyclonal Anti-RAN (aa 197-210) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RAN (aa 197-210) Antibody: Peptide with sequence C-YEHDLEVAQTTALP, from the C Terminus of the protein sequence according to NP_006316.1. |
Ran Rabbit polyclonal Antibody
Applications | FC, IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Ran |
RAN (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human RAN |
Goat Polyclonal Antibody against RAN
Applications | WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AAQGEPQVQFKLV-C, from the N Terminus of the protein sequence according to NP_006316. |
Rabbit anti-RAN polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit Polyclonal Anti-RAN Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAN antibody: synthetic peptide directed towards the middle region of human RAN. Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA |
Rabbit Polyclonal Anti-RAN Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAN Antibody: A synthesized peptide derived from human RAN |
RAN rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |